Recombinant Mouse Ifna7 protein

• Cat.No.: Ifna7-3072M
• Product Overview: Recombinant Mouse Ifna7 protein(P06799)(24-190aa) was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• Protein Length: 24-190aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 19.0 kDa
• AA Sequence: CDLPQTHNLRNKRALTLLVKMRRLSPLSCLKDRKDFGFPQAKVDAQQIQEAQAIPVLSELTQQILNIFTSKDSSAAWNATLLDSVCNDLHQQLNDLQGCLMQEVGVQELSLTQEDSLLAVRKYFHRITVFLREKKHSPCAWEVVRAEIWRALSSSANLLARLSEKKE
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Ifna7 interferon alpha 7 [ Mus musculus ]
• Official Symbol: Ifna7
• Synonyms: IFNA7; interferon alpha 7; interferon alpha-7; IFN-alpha-7; interferon alpha family, gene 7; Ifa7
• Gene ID: 15970
• mRNA Refseq: NM_008334
• Protein Refseq: NP_032360