Recombinant Mouse HMGCR Protein (700-860 aa), His-tagged

• Cat.No.: HMGCR-2377M
• Product Overview: Recombinant Mouse HMGCR Protein (700-860 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Partial.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 700-860 aa
• Description: Transmembrane glycoprotein that is the rate-limiting enzyme in cholesterol biosynthesis as well as in the biosynthesis of nonsterol isoprenoids that are essential for normal cell function including ubiquinone and geranylgeranyl proteins.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 20.4 kDa
• AA Sequence: GRGKTVVCEAVIPAKVVREVLKTTTEAMVDVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGH
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Hmgcr 3-hydroxy-3-methylglutaryl-Coenzyme A reductase [ Mus musculus ]
• Official Symbol: HMGCR
• Synonyms: HMGCR; HMG-CoA reductase; 3-hydroxy-3-methylglutaryl-CoA reductase; Red; HMG-CoAR; MGC103269
• Gene ID: 15357
• mRNA Refseq: NM_008255
• Protein Refseq: NP_032281
• UniProt ID: Q01237