Recombinant Human HFE protein, His&Myc-tagged

• Cat.No.: HFE-4467H
• Product Overview: Recombinant Human HFE protein(Q30201)(23-306aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli

Specification

• Source: E. coli
• Species: Human
• Tag: His&Myc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 40.2 kDa
• Protein length: 23-306aa
• AA Sequence: RLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPSPSGTLV
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: HFE hemochromatosis [ Homo sapiens ]
• Official Symbol: HFE
• Synonyms: HFE; hemochromatosis; hereditary hemochromatosis protein; high Fe; HLA H; MHC class I-like protein HFE; hereditary hemochromatosis protein HLA-H; HH; HFE1; HLA-H; MVCD7; TFQTL2; MGC103790; MGC:150812; dJ221C16.10.1; IMAGE:40125754
• Gene ID: 3077
• mRNA Refseq: NM_000410
• Protein Refseq: NP_000401
• MIM: 613609
• UniProt ID: Q30201