Recombinant Human HFE protein, His&Myc-tagged
Cat.No. : | HFE-4467H |
Product Overview : | Recombinant Human HFE protein(Q30201)(23-306aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 23-306aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 40.2 kDa |
AA Sequence : | RLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPSPSGTLV |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | HFE hemochromatosis [ Homo sapiens ] |
Official Symbol | HFE |
Synonyms | HFE; hemochromatosis; hereditary hemochromatosis protein; high Fe; HLA H; MHC class I-like protein HFE; hereditary hemochromatosis protein HLA-H; HH; HFE1; HLA-H; MVCD7; TFQTL2; MGC103790; MGC:150812; dJ221C16.10.1; IMAGE:40125754; |
Gene ID | 3077 |
mRNA Refseq | NM_000410 |
Protein Refseq | NP_000401 |
MIM | 613609 |
UniProt ID | Q30201 |
◆ Cell & Tissue Lysates | ||
HFE-5572HCL | Recombinant Human HFE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HFE Products
Required fields are marked with *
My Review for All HFE Products
Required fields are marked with *
0
Inquiry Basket