Recombinant Mouse Hbb-b2 Protein (2-147 aa), His-tagged

Cat.No. : Hbb-b2-1618M
Product Overview : Recombinant Mouse Hbb-b2 Protein (2-147 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Yeast
Tag : His
Protein Length : 2-147 aa
Description : Involved in oxygen transport from the lung to the various peripheral tissues.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 17.7 kDa
AA Sequence : VHLTDAEKSAVSCLWAKVNPDEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNPKVKAHGKKVITAFNEGLKNLDNLKGTFASLSELHCDKLHVDPENFRLLGNAIVIVLGHHLGKDFTPAAQAAFQKVVAGVATALAHKYH
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name Hbb-b2 hemoglobin, beta adult minor chain [ Mus musculus (house mouse) ]
Official Symbol Hbb-b2
Synonyms Hbb2; Hbbt2; beta2; AI036344;
Gene ID 15130
mRNA Refseq NM_016956
Protein Refseq NP_058652
UniProt ID P02089

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Hbb-b2 Products

Required fields are marked with *

My Review for All Hbb-b2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon