Recombinant Mouse Gzma protein, His-B2M-tagged

Cat.No. : Gzma-3009M
Product Overview : Recombinant Mouse Gzma protein(P11032)(29-260aa), fused to N-terminal His tag and B2M tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : B2M&His
Protein Length : 29-260aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 39.6 kDa
AA Sequence : IIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKKIMKGSV
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name Gzma granzyme A [ Mus musculus ]
Official Symbol Gzma
Synonyms GZMA; granzyme A; H factor; BLT esterase; fragmentin-1; Hanukah factor; serine esterase 1; t cell-specific serine protease 1; autocrine thymic lymphoma granzyme-like serine protease; Hf; SE1; TSP1; Ctla3; TSP-1; Ctla-3; AW494114;
Gene ID 14938
mRNA Refseq NM_010370
Protein Refseq NP_034500

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Gzma Products

Required fields are marked with *

My Review for All Gzma Products

Required fields are marked with *

0

Inquiry Basket

cartIcon