Recombinant Mouse Gstm1 Protein

• Cat.No.: Gstm1-7220M
• Product Overview: Recombinant mouse GSTM1 protein without tag was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Description: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
• Source: E. coli
• Species: Mouse
• Form: Liquid
• Molecular Mass: 25.9 kDa
• Protein length: 1-218
• AA Sequence: MPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLARKHHLDGETEEERIRADIVENQVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK
• Endotoxin: < 1.0 EU/μg of protein (determined by LAL method)
• Purity: > 95 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for up to two weeks or (in aliquots) at -20 or -70 centigrade for longer.
  Avoid repeated freezing and thawing.
• Concentration: 1.0 mg/mL (determined by Bradford assay)
• Storage Buffer: PBS (pH 7.4) containing 5 mM glutathione

Gene Information

• Gene Name: Gstm1 glutathione S-transferase, mu 1 [ Mus musculus (house mouse) ]
• Official Symbol: Gstm1
• Synonyms: Gstm1; glutathione S-transferase, mu 1; Gstb; Gstb-; Gstb1; Gstb-1; glutathione S-transferase Mu 1; GST 1-1; GST class-mu 1; glutathione S-transferase GT8.7; pmGT10; EC 2.5.1.18
• Gene ID: 14862
• mRNA Refseq: NM_010358
• Protein Refseq: NP_034488
• UniProt ID: P10649