Recombinant Mouse Gsta1 Protein, His-tagged

• Cat.No.: Gsta1-7218M
• Product Overview: Recombinant mouse Gsta1, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 1-223
• Description: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
• Form: Liquid
• Molecular Mass: 28 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSMAGKPVLHYFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIGQLVLCPPDQREAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLEVLLYVEEFDASLLTPFPLLKAFKSRISSLPNVKKFLQPGSQRKPPMDAKQIQEARKAFKIQ
• Purity: > 95 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 1.0 mg/mL (determined by bradford assay)
• Storage Buffer: In Phosphate buffered saline (pH7.4) containing 10 % glycerol, 1 mM DTT.

Gene Information

• Gene Name: Gsta1 glutathione S-transferase, alpha 1 (Ya) [ Mus musculus (house mouse) ]
• Official Symbol: Gsta1
• Synonyms: Gsta1; glutathione S-transferase, alpha 1 (Ya); Gst2-; Gst2-1; glutathione S-transferase A1; 13-hydroperoxyoctadecadienoate peroxidase; GST class-alpha member 1; androst-5-ene-3,17-dione isomerase; glutathione S-transferase Ya; glutathione S-transferase Ya1; EC 2.5.1.18
• Gene ID: 14857
• mRNA Refseq: NM_008181
• Protein Refseq: NP_032207
• UniProt ID: P13745