Recombinant Mouse Got1 Protein, His-tagged

Cat.No. : Got1-7214M
Product Overview : Recombinant mouse Got1 fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 1-413
Description : Biosynthesis of L-glutamate from L-aspartate or L-cysteine. Important regulator of levels of glutamate, the major excitatory neurotransmitter of the vertebrate central nervous system. Acts as a scavenger of glutamate in brain neuroprotection. The aspartate aminotransferase activity is involved in hepatic glucose synthesis during development and in adipocyte glyceroneogenesis. Using L-cysteine as substrate, regulates levels of mercaptopyruvate, an important source of hydrogen sulfide. Mercaptopyruvate is converted into H2S via the action of 3-mercaptopyruvate sulfurtransferase (3MST). Hydrogen sulfide is an important synaptic modulator and neuroprotectant in the brain.
Form : Liquid
Molecular Mass : 48.6 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSMAPPSVFAQVPQAPPVLVFKLTADFRDDPDPRKVNLGVGAYRTDESQPWVLPVVRKVEQKIANDNSLNHEYLPILGLAEFRSCASRLVLGDNSPAIRENRVGGVQSLGGTGALRIGADFLGRWYNGTDNKNTPIYVSSPTWENHNAVFSAAGFKDIRPYCYWDAEKRGLDLQGFLNDLENAPEFSIFVLHACAHNPTGTDPTPEQWKQIAAVMQRRFLFPFFDSAYQGFASGDLEKDAWAIRYFVSEGFELFCAQSFSKNFGLYNERVGNLTVVGKESDSVLRVLSQMEKIVRITWSNPPAQGARIVAATLSDPELFKEWKGNVKTMADRILTMRSELRARLEALKTPGTWSHITEQIGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINMCGLTTKNLDYVATSIHEAVTKIQ
Purity : > 95 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration : 0.5 mg/mL (determined by bradford assay)
Storage Buffer : In Phosphate buffered saline (pH7.4) containing 10 % glycerol, 1 mM DTT.
Gene Name Got1 glutamic-oxaloacetic transaminase 1, soluble [ Mus musculus (house mouse) ]
Official Symbol Got1
Synonyms Got1; glutamic-oxaloacetic transaminase 1, soluble; cA; Got-; cCAT; Got-1; cAspAT; AI789014; aspartate aminotransferase, cytoplasmic; cysteine aminotransferase, cytoplasmic; cysteine transaminase, cytoplasmic; cytosolic aspartate aminotransferase; glutamate oxaloacetate transaminase 1, soluble; transaminase A; EC 2.6.1.1; EC 2.6.1.3
Gene ID 14718
mRNA Refseq NM_010324
Protein Refseq NP_034454
UniProt ID P05201

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Got1 Products

Required fields are marked with *

My Review for All Got1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon