Recombinant Mouse Got1 Protein, His-tagged
Cat.No. : | Got1-7214M |
Product Overview : | Recombinant mouse Got1 fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-413 |
Description : | Biosynthesis of L-glutamate from L-aspartate or L-cysteine. Important regulator of levels of glutamate, the major excitatory neurotransmitter of the vertebrate central nervous system. Acts as a scavenger of glutamate in brain neuroprotection. The aspartate aminotransferase activity is involved in hepatic glucose synthesis during development and in adipocyte glyceroneogenesis. Using L-cysteine as substrate, regulates levels of mercaptopyruvate, an important source of hydrogen sulfide. Mercaptopyruvate is converted into H2S via the action of 3-mercaptopyruvate sulfurtransferase (3MST). Hydrogen sulfide is an important synaptic modulator and neuroprotectant in the brain. |
Form : | Liquid |
Molecular Mass : | 48.6 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSMAPPSVFAQVPQAPPVLVFKLTADFRDDPDPRKVNLGVGAYRTDESQPWVLPVVRKVEQKIANDNSLNHEYLPILGLAEFRSCASRLVLGDNSPAIRENRVGGVQSLGGTGALRIGADFLGRWYNGTDNKNTPIYVSSPTWENHNAVFSAAGFKDIRPYCYWDAEKRGLDLQGFLNDLENAPEFSIFVLHACAHNPTGTDPTPEQWKQIAAVMQRRFLFPFFDSAYQGFASGDLEKDAWAIRYFVSEGFELFCAQSFSKNFGLYNERVGNLTVVGKESDSVLRVLSQMEKIVRITWSNPPAQGARIVAATLSDPELFKEWKGNVKTMADRILTMRSELRARLEALKTPGTWSHITEQIGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINMCGLTTKNLDYVATSIHEAVTKIQ |
Purity : | > 95 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 0.5 mg/mL (determined by bradford assay) |
Storage Buffer : | In Phosphate buffered saline (pH7.4) containing 10 % glycerol, 1 mM DTT. |
Gene Name | Got1 glutamic-oxaloacetic transaminase 1, soluble [ Mus musculus (house mouse) ] |
Official Symbol | Got1 |
Synonyms | Got1; glutamic-oxaloacetic transaminase 1, soluble; cA; Got-; cCAT; Got-1; cAspAT; AI789014; aspartate aminotransferase, cytoplasmic; cysteine aminotransferase, cytoplasmic; cysteine transaminase, cytoplasmic; cytosolic aspartate aminotransferase; glutamate oxaloacetate transaminase 1, soluble; transaminase A; EC 2.6.1.1; EC 2.6.1.3 |
Gene ID | 14718 |
mRNA Refseq | NM_010324 |
Protein Refseq | NP_034454 |
UniProt ID | P05201 |
◆ Recombinant Proteins | ||
GOT1-2051HFL | Recombinant Full Length Human GOT1 Protein, C-Flag-tagged | +Inquiry |
GOT1-60H | Active Recombinant Human GOT1 protein, His-tagged | +Inquiry |
GOT1-5816C | Recombinant Cattle GOT1 protein, His & T7-tagged | +Inquiry |
Got1-3668M | Recombinant Mouse Got1, His-tagged | +Inquiry |
GOT1-12290Z | Recombinant Zebrafish GOT1 | +Inquiry |
◆ Native Proteins | ||
GOT1-5353P | Active Native Porcine GOT1 protein | +Inquiry |
GOT1-5351H | Native Human Glutamic-Oxaloacetic Transaminase 1, Soluble (aspartate aminotransferase 1) | +Inquiry |
GOT1-01H | Active Native Human GOT1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GOT1-5824HCL | Recombinant Human GOT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Got1 Products
Required fields are marked with *
My Review for All Got1 Products
Required fields are marked with *
0
Inquiry Basket