Recombinant Mouse Got1 Protein, His-tagged

• Cat.No.: Got1-7214M
• Product Overview: Recombinant mouse Got1 fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Description: Biosynthesis of L-glutamate from L-aspartate or L-cysteine. Important regulator of levels of glutamate, the major excitatory neurotransmitter of the vertebrate central nervous system. Acts as a scavenger of glutamate in brain neuroprotection. The aspartate aminotransferase activity is involved in hepatic glucose synthesis during development and in adipocyte glyceroneogenesis. Using L-cysteine as substrate, regulates levels of mercaptopyruvate, an important source of hydrogen sulfide. Mercaptopyruvate is converted into H2S via the action of 3-mercaptopyruvate sulfurtransferase (3MST). Hydrogen sulfide is an important synaptic modulator and neuroprotectant in the brain.
• Source: E. coli
• Species: Mouse
• Tag: His
• Form: Liquid
• Molecular Mass: 48.6 kDa
• Protein length: 1-413
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSMAPPSVFAQVPQAPPVLVFKLTADFRDDPDPRKVNLGVGAYRTDESQPWVLPVVRKVEQKIANDNSLNHEYLPILGLAEFRSCASRLVLGDNSPAIRENRVGGVQSLGGTGALRIGADFLGRWYNGTDNKNTPIYVSSPTWENHNAVFSAAGFKDIRPYCYWDAEKRGLDLQGFLNDLENAPEFSIFVLHACAHNPTGTDPTPEQWKQIAAVMQRRFLFPFFDSAYQGFASGDLEKDAWAIRYFVSEGFELFCAQSFSKNFGLYNERVGNLTVVGKESDSVLRVLSQMEKIVRITWSNPPAQGARIVAATLSDPELFKEWKGNVKTMADRILTMRSELRARLEALKTPGTWSHITEQIGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINMCGLTTKNLDYVATSIHEAVTKIQ
• Purity: > 95 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 0.5 mg/mL (determined by bradford assay)
• Storage Buffer: In Phosphate buffered saline (pH7.4) containing 10 % glycerol, 1 mM DTT.

Gene Information

• Gene Name: Got1 glutamic-oxaloacetic transaminase 1, soluble [ Mus musculus (house mouse) ]
• Official Symbol: Got1
• Synonyms: Got1; glutamic-oxaloacetic transaminase 1, soluble; cA; Got-; cCAT; Got-1; cAspAT; AI789014; aspartate aminotransferase, cytoplasmic; cysteine aminotransferase, cytoplasmic; cysteine transaminase, cytoplasmic; cytosolic aspartate aminotransferase; glutamate oxaloacetate transaminase 1, soluble; transaminase A; EC 2.6.1.1; EC 2.6.1.3
• Gene ID: 14718
• mRNA Refseq: NM_010324
• Protein Refseq: NP_034454
• UniProt ID: P05201