Recombinant Mouse Gmfb protein

• Cat.No.: Gmfb-1885M
• Product Overview: Recombinant Mouse Gmfb protein was expressed in Escherichia coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• ProteinLength: 141
• Description: The glia maturation factor beta belongs to the actin-binding proteins ADF family, GMF subfamily. It contains an ADF-H domain, but the research of crystallography and NMR reveals that there are structures different between human and mouse ADF-H domain. GMF-β is involved in the differentiation, maintenance, and regeneration of the nervous system. It also inhibition of proliferation of tumor cells.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
• Molecular Mass: Approximately 16.6 kDa, a single non-glycosylated polypeptide chain containing 141 amino acid residues.
• AA Sequence: SESLVVCDVAEDLVEKLRKFRFRKETHNAAIIMKIDKDERLVVLDEELEGVSPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH
• Endotoxin: Less than 1 EU/μg of rMuGMF-β as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Gmfb
• Official Symbol: Gmfb
• Synonyms: GMFB; glia maturation factor, beta; glia maturation factor beta; GMF-beta; C79176; AI851627; D14Ertd630e; 3110001H22Rik; 3110001O16Rik
• Gene ID: 63985
• mRNA Refseq: NM_022023
• Protein Refseq: NP_071306
• UniProt ID: Q9CQI3