Recombinant Mouse Gm1987 Protein

• Cat.No.: Gm1987-027M
• Product Overview: Purified recombinant protein of Mouse predicted gene 1987 (Gm1987) without tag was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Inhibits hemopoiesis and stimulates chemotaxis. Chemotactic in vitro for thymocytes and activated T-cells, but not for B-cells, macrophages, or neutrophils. Potent mesangial cell chemoattractant. Shows preferential activity towards naive T-cells. May play a role in mediating homing of lymphocytes to secondary lymphoid organs.
• Molecular Mass: 12 kDa
• AA Sequence: SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFSPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: Gm1987 predicted gene 1987 [ Mus musculus (house mouse) ]
• Official Symbol: Gm1987
• Synonyms: Gm1987; predicted gene 1987; 100038965
• Gene ID: 100504362
• mRNA Refseq: NM_001193667
• Protein Refseq: NP_001180596
• UniProt ID: P84444