Recombinant Mouse Gja1 protein, His&Myc-tagged
Cat.No. : | Gja1-2222M |
Product Overview : | Recombinant Mouse Gja1 protein(P23242)(232-382aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 232-382aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 20.3 kDa |
AA Sequence : | FFKGVKDRVKGRSDPYHATTGPLSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDSQNAKKVAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gja1 gap junction protein, alpha 1 [ Mus musculus ] |
Official Symbol | Gja1 |
Synonyms | GJA1; gap junction protein, alpha 1; gap junction alpha-1 protein; connexin 43; connexin-43; alpha 1 connexin; gap junction 43 kDa heart protein; gap junction membrane channel protein alpha 1; Cx43; Npm1; Cnx43; Gja-1; AU042049; AW546267; Cx43alpha1; connexin43; |
Gene ID | 14609 |
mRNA Refseq | NM_010288 |
Protein Refseq | NP_034418 |
◆ Recombinant Proteins | ||
GJA1-2081H | Recombinant Human GJA1 Protein (Phe232-Ile382), N-His tagged | +Inquiry |
GJA1-350H | Recombinant Human GJA1 protein, His-tagged | +Inquiry |
Gja1-351M | Recombinant Mouse Gja1 Protein, His-tagged | +Inquiry |
GJA1-1677R | Recombinant Rhesus Macaque GJA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GJA1-1857R | Recombinant Rhesus monkey GJA1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GJA1-5923HCL | Recombinant Human GJA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gja1 Products
Required fields are marked with *
My Review for All Gja1 Products
Required fields are marked with *
0
Inquiry Basket