Recombinant Mouse Gdnf protein
Cat.No. : | Gdnf-249M |
Product Overview : | Recombinant Mouse Gdnf protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 134 |
Description : | This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. The recombinant form of this protein, a highly conserved neurotrophic factor, was shown to promote the survival and differentiation of dopaminergic neurons in culture, and was able to prevent apoptosis of motor neurons induced by axotomy. This protein is a ligand for the product of the RET (rearranged during transfection) protooncogene. Mutations in this gene may be associated with Hirschsprung disease and Tourette syndrome. This gene encodes multiple protein isoforms that may undergo similar proteolytic processing. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, with 0.05 % Tween-20. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using rat C6 cells is less than 0.2 ng/ml, corresponding to a specific activity of > 5.0 × 10⁶ IU/mg. |
Molecular Mass : | Approximately 29.9 kDa, a homodimeric protein consisting of two 134 amino acid non-glycosylated polypeptide chains. |
AA Sequence : | SPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCESAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDNLVYHILRKHSAKRCGCI |
Endotoxin : | Less than 0.1 EU/μg of rMuGDNF as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Gdnf |
Official Symbol | Gdnf |
Synonyms | GDNF; glial cell line derived neurotrophic factor; glial cell line-derived neurotrophic factor; ATF; mGDNF; neurotrophic factor; astrocyte-derived trophic factor; AI385739; |
Gene ID | 14573 |
mRNA Refseq | NM_010275 |
Protein Refseq | NP_034405 |
UniProt ID | P48540 |
◆ Recombinant Proteins | ||
Gdnf-780R | Recombinant Rat Gdnf protein, His-tagged | +Inquiry |
GDNF-150H | Recombinant Human GDNF Protein | +Inquiry |
GDNF-22H | Active Recombinant Human GDNF, His-tagged | +Inquiry |
Gdnf-779M | Recombinant Mouse Gdnf protein, His-tagged | +Inquiry |
GDNF-8858H | Active Recombinant Human GDNF,His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GDNF-1549HCL | Recombinant Human GDNF cell lysate | +Inquiry |
GDNF-400RCL | Recombinant Rat GDNF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gdnf Products
Required fields are marked with *
My Review for All Gdnf Products
Required fields are marked with *
0
Inquiry Basket