Recombinant Mouse Gdf5 protein
Cat.No. : | Gdf5-651M |
Product Overview : | Recombinant Mouse Gdf5 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 120 |
Description : | Growth/differentiation factors (GDF-1 to GDF-15) are members of the BMP family of TGF-beta superfamily proteins. They are produced as inactive preproproteins which are then cleaved and assembled into active secreted homodimers. GDF dimers are disulfide-linked with the exception of GDF-3 and -9. GDF proteins are important during embryonic development, particularly in the skeletal, nervous, and muscular systems. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by inducing alkaline phosphatase production of murine ATDC5 cells is less than 1.0 μg/ml, corresponding to a specific activity of > 1000 IU/mg. |
Molecular Mass : | Approximately 27.2 kDa, a disulfide-linked homodimeric protein containing two 120 amino acids. |
AA Sequence : | APLANRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR |
Endotoxin : | Less than 0.1 EU/µg of rMuGDF-5/BMP-14 as determined by LAL method. |
Purity : | >96% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 4 mM HCl to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Gdf5 |
Official Symbol | Gdf5 |
Synonyms | GDF5; growth differentiation factor 5; growth/differentiation factor 5; GDF-5; brachypodism; cartilage-derived morphogenetic protein-1; bp; brp; Cdmp-1; |
Gene ID | 14563 |
mRNA Refseq | NM_008109 |
Protein Refseq | NP_032135 |
UniProt ID | P43027 |
◆ Recombinant Proteins | ||
GDF-5300H | Recombinant Human Growth Differentiation Factor 5, His-tagged | +Inquiry |
GDF5-27678TH | Recombinant Human GDF5, His-tagged | +Inquiry |
GDF5-6288M | Recombinant Mouse GDF5 Protein | +Inquiry |
Gdf5-651M | Recombinant Mouse Gdf5 protein | +Inquiry |
GDF5-299H | Active Recombinant Human GDF5 Protein (Ala382-Arg501), C-His tagged, Animal-free, Carrier-free | +Inquiry |
◆ Cell & Tissue Lysates | ||
GDF5-5968HCL | Recombinant Human GDF5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gdf5 Products
Required fields are marked with *
My Review for All Gdf5 Products
Required fields are marked with *
0
Inquiry Basket