Recombinant Mouse Gdf5 protein

• Cat.No.: Gdf5-651M
• Product Overview: Recombinant Mouse Gdf5 protein was expressed in Escherichia coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• Protein Length: 120
• Description: Growth/differentiation factors (GDF-1 to GDF-15) are members of the BMP family of TGF-beta superfamily proteins. They are produced as inactive preproproteins which are then cleaved and assembled into active secreted homodimers. GDF dimers are disulfide-linked with the exception of GDF-3 and -9. GDF proteins are important during embryonic development, particularly in the skeletal, nervous, and muscular systems.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by inducing alkaline phosphatase production of murine ATDC5 cells is less than 1.0 μg/ml, corresponding to a specific activity of > 1000 IU/mg.
• Molecular Mass: Approximately 27.2 kDa, a disulfide-linked homodimeric protein containing two 120 amino acids.
• AA Sequence: APLANRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR
• Endotoxin: Less than 0.1 EU/µg of rMuGDF-5/BMP-14 as determined by LAL method.
• Purity: >96% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 4 mM HCl to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Gdf5
• Official Symbol: Gdf5
• Synonyms: GDF5; growth differentiation factor 5; growth/differentiation factor 5; GDF-5; brachypodism; cartilage-derived morphogenetic protein-1; bp; brp; Cdmp-1
• Gene ID: 14563
• mRNA Refseq: NM_008109
• Protein Refseq: NP_032135
• UniProt ID: P43027