Recombinant Mouse FUCA1 Protein, His-SUMO-tagged

Cat.No. : FUCA1-1217M
Product Overview : Recombinant Mouse FUCA1 Protein (18-452aa) was expressed in E. coli with N-terminal His-SUMO-tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E. coli
Species : Mouse
Tag : His&SUMO
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 66.6 kDa
AA Sequence : LAPRRFTPDWQSLDSRPLPSWFDEAKFGVFVHWGVFSVPAWGSEWFWWHWQGDRMPAYQRFMTENYPPGFSYADFAPQFTARFFHPDQWAELFQAAGAKYVVLTTKHHEGFTNWPSPVSWNWNSKDVGPHRDLVGELGAAVRKRNIRYGLYHSLLEWFHPLYLLDKKNGFKTQHFVRAKTMPELYDLVNSYKPDLIWSDGEWECPDTYWNSTSFLAWLYNDSPVKDEVIVNDRWGQNCSCHHGGYYNCQDKYKPQSLPDHKWEMCTSMDRASWGYRKDMTMSTIAKENEIIEELVQTVSLGGNYLLNIGPTKDGLIVPIFQERLLAVGKWLQINGEAIYASKPWRVQSEKNKTVVWYTTKNATVYATFLYWPENGIVNLKSPKTTSATKITMLGLEGDLSWTQDPLEGVLISLPQLPPTVLPVEFAWTLKLTKVN
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Protein length : 18-452 a.a.
Gene Name Fuca1 fucosidase, alpha-L- 1, tissue [ Mus musculus (house mouse) ]
Official Symbol FUCA1
Synonyms Afuc; Fuca; 0610006A03Rik; 9530055J05Rik; alpha-L-fucosidase 1; alpha-L-fucosidase I; alpha-L-fucoside fucohydrolase 1; tissue alpha-L-fucosidase
Gene ID 71665
mRNA Refseq NM_024243.4
Protein Refseq NP_077205.3
UniProt ID Q99LJ1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FUCA1 Products

Required fields are marked with *

My Review for All FUCA1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon