Recombinant Mouse FPR1 Protein (1-35 aa), His-GST-Myc-tagged

• Cat.No.: FPR1-2444M
• Product Overview: Recombinant Mouse FPR1 Protein (1-35 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-GST tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Immunology. Protein Description: Partial.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&GST&Myc
• ProteinLength: 1-35 aa
• Description: High affinity receptor for N-formyl-methionyl peptides (fMLP), which are powerful neutrophil chemotactic factors. Binding of fMLP to the receptor stimulates intracellular calcium mobilization and superoxide anion release. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 33.7 kDa
• AA Sequence: MDTNMSLLMNKSAVNLMNVSGSTQSVSAGYIVLDV
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Fpr1 formyl peptide receptor 1 [ Mus musculus ]
• Official Symbol: FPR1
• Synonyms: FPR1; formyl peptide receptor 1; fMet-Leu-Phe receptor; fMLP receptor; lipoxin A4 receptor; FPR; LXA4R; fMLF-R
• Gene ID: 14293
• mRNA Refseq: NM_013521
• Protein Refseq: NP_038549
• UniProt ID: P33766