Recombinant Mouse Fgf21 Protein, His-tagged
Cat.No. : | Fgf21-7399M |
Product Overview : | Recombinant Mouse Fgf21 protein with a His tag was expressed in insect cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 29-210 |
Description : | Stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression (but not SLC2A4/GLUT4 expression). Activity probably requires the presence of KLB. |
Form : | Liquid |
Molecular Mass : | 21.0 kDa |
AA Sequence : | AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYASLEHHHHHH |
Endotoxin : | < 1.0 EU/μg of protein (determined by LAL method) |
Purity : | > 90 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 0.5 mg/mL (determined by absorbance at 280nm) |
Storage Buffer : | Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol. |
Gene Name | Fgf21 fibroblast growth factor 21 [ Mus musculus (house mouse) ] |
Official Symbol | Fgf21 |
Synonyms | Fgf21; fibroblast growth factor 21; Fgf8c; fibroblast growth factor 21; fibroblast growth factor 8c |
Gene ID | 56636 |
mRNA Refseq | NM_020013 |
Protein Refseq | NP_064397 |
UniProt ID | Q9JJN1 |
◆ Recombinant Proteins | ||
FGF21-192H | Recombinant Human FGF21 protein, His/S-tagged | +Inquiry |
FGF21-907H | Recombinant Human FGF21 Protein, His (Fc)-Avi-tagged | +Inquiry |
FGF21-81H | Recombinant Active Human FGF21 Protein, His-tagged(C-ter) | +Inquiry |
FGF21-117H | Active Recombinant Human FGF21 Protein (His29-Ser209), C-His tagged, Animal-free, Carrier-free | +Inquiry |
FGF21-415F | Active Recombinant Human FGF21 Protein (182 aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF21-1890MCL | Recombinant Mouse FGF21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Fgf21 Products
Required fields are marked with *
My Review for All Fgf21 Products
Required fields are marked with *
0
Inquiry Basket