Active Recombinant Human FGF21 Protein (182 aa)

• Cat.No.: FGF21-120F
• Product Overview: Recombinant Human FGF21 Protein without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 182
• Description: Fibroblast growth factor 21 (FGF21) belongs to the large FGF family which has at least 23 members. All FGF family members are heparin binding growth factors with a core 120 amino acid (aa) FGF domain that allows for a common tertiary structure. FGFs are expressed during embryonic development and in restricted adult tissues. Four distinct but related classes of FGF receptors, FGF R1, 2, 3, and 4, exist. FGF-21, in the presence of betaKlotho as a protein cofactor, signals through the FGFR 1c and 4 receptors and stimulates insulin independent glucose uptake by adipocytes.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by the dose-dependent stimulation of the proliferation of BaF3 cells expressing FGF receptors is 0.06-0.4 μg/mL in the presence of betaKlotho and Heparin, corresponding to a Specific Activity of ＞2.5× 10^3 IU/mg.
• Molecular Mass: Approximately 19.5 kDa, a single non-glycosylated polypeptide chain containing 182 amino acids.
• AA Sequence: MHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
• Endotoxin: Less than 1 EU/mg of rHuFGF-21 as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable for several weeks at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: FGF21 fibroblast growth factor 21 [ Homo sapiens ]
• Official Symbol: FGF21
• Synonyms: FGF21; fibroblast growth factor 21; FGF-21
• Gene ID: 26291
• mRNA Refseq: NM_019113
• Protein Refseq: NP_061986
• MIM: 609436
• UniProt ID: Q9NSA1