Recombinant Mouse Fgf17 protein

• Cat.No.: Fgf17-8333M
• Product Overview: Recombinant Mouse Fgf17 protein was expressed in Escherichia coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• Protein Length: 194
• Description: FGF-17 is a member of the FGF superfamily of heparin-binding mitogenic molecules characterized by the presence of a core, 120 amino acid (aa) beta-trefoil structure. The mRNA of FGF-17 was found in midgestation of embryo and multiple adult tissues, and is preferentially expressed in specific sites, such as embryonic brain, developing skeleton and arteries.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 20 mM Tris-HCl, pH 8.0, 700 mM NaCl, with 0.02 % Tween-20.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine balb/c 3T3 cells is less than 10 ng/ml, corresponding to a specific activity of > 1.0 × 10⁵ IU/mg in the presence of 10 μg/ml of heparin.
• Molecular Mass: Approximately 22.5 kDa, a single non-glycosylated polypeptide chain containing 194 amino acids.
• AA Sequence: TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAERQKQFEFVGSAPTRRTKRTRRPQSQT
• Endotoxin: Less than 0.1 EU/µg of rMuFGF-17 as determined by LAL method.
• Purity: >98% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile PBS to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Fgf17
• Official Symbol: Fgf17
• Synonyms: FGF17; fibroblast growth factor 17; FGF-17
• Gene ID: 14171
• mRNA Refseq: NM_008004
• Protein Refseq: NP_032030
• UniProt ID: P63075