| Species : |
Mouse |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
127 |
| Description : |
The fatty-acid-binding proteins (FABPs) are a family of carrier proteins for fatty acids and other lipophilic substances such as eicosanoids and retinoids. These proteins are thought to facilitate the transfer of fatty acids between extra- and intracellular membranes. Fatty acid-binding protein 1 (FABP1) encoded by the FABP1 gene, also known as liver-type fatty acid-binding protein (L-FABP), is a member of FABP family and it is a small, highly conserved, cytoplasmic proteins. In addition, FABP1 binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. Furthermore, it may be involved in intracellular lipid transport. Through amino acid sequence comparison, murine FABP1 shares 84% and 94% a.a. sequence identity with human and rat FABP1. |
| Form : |
Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, 2 % trehalose. |
| Bio-activity : |
Fully biologically active when compared to standard. The binding affinity of rMuFABP1 for the synthetic ligand cis-parinaric acid has been measured by fluorescence titration. Half maximal fluorescence of 2.5 μM rMuFABP1 is achieved with approximately 5 μM cis-paranaric acid. |
| Molecular Mass : |
Approximately 14.2 kDa, a single non-glycosylated polypeptide chain containing 127 amino acids. |
| AA Sequence : |
MNFSGKYQLQSQENFEPFMKAIGLPEDLIQKGKDIKGVSEIVHEGKKIKLTITYGPKVVRNEFTLGEECELETMTGEKVKAVVKLEGDNKMVTTFKGIKSVTELNGDTITNTMTLGDIVYKRVSKRI |
| Endotoxin : |
Less than 1 EU/µg of rMuFABP1 as determined by LAL method. |
| Purity : |
>95% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
