Recombinant Mouse F3 Protein, His-tagged
Cat.No. : | F3-7203M |
Product Overview : | Recombinant Mouse F3 Protein with a His tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Tag : | His |
Protein Length : | 29-251 |
Description : | This gene encodes a membrane-bound glycoprotein that forms the primary physiological initiator of the blood coagulation process following vascular damage. The encoded protein binds to coagulation factor VIIa and the ensuing complex catalyzes the proteolytic activation of coagulation factors IX and X. Mice lacking encoded protein die in utero resulting from massive hemorrhaging in both extraembryonic and embryonic vessels. A severe deficiency of the encoded protein in mice results in impaired uterine homeostasis, shorter life spans due to spontaneous fatal hemorrhages and cardiac fibrosis. |
Form : | Liquid |
Molecular Mass : | 26.4 kDa |
AA Sequence : | ADPAGIPEKAFNLTWISTDFKTILEWQPKPTNYTYTVQISDRSRNWKNKCFSTTDTECDLTDEIVKDVTWAYEAKVLSVPRRNSVHGDGDQLVIHGEEPPFTNAPKFLPYRDTNLGQPVIQQFEQDGRKLNVVVKDSLTLVRKNGTFLTLRQVFGKDLGYIITYRKGSSTGKKTNITNTNEFSIDVEEGVSYCFFVQAMIFSRKTNQNSPGSSTVCTEQWKSFLGEHHHHHH |
Endotoxin : | < 1.0 EU/μg of protein (determined by LAL method) |
Purity : | > 95 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 0.5 mg/mL (determined by absorbance at 280nm) |
Storage Buffer : | Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol. |
Gene Name | F3 coagulation factor III [ Mus musculus (house mouse) ] |
Official Symbol | F3 |
Synonyms | F3; coagulation factor III; TF; Cf3; Cf-3; CD142; AA409063; tissue factor |
Gene ID | 14066 |
mRNA Refseq | NM_010171 |
Protein Refseq | NP_034301 |
UniProt ID | P20352 |
◆ Recombinant Proteins | ||
F3-368R | Recombinant Rabbit F3 Protein, His-tagged | +Inquiry |
F3-7203M | Recombinant Mouse F3 Protein, His-tagged | +Inquiry |
F3-958H | Recombinant Human F3 Protein, MYC/DDK-tagged | +Inquiry |
F3-6924H | Active Recombinant Human F3 protein, Fc-tagged | +Inquiry |
RFL1640OF | Recombinant Full Length Rabbit Tissue Factor(F3) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
F3-1691HCL | Recombinant Human F3 cell lysate | +Inquiry |
F3-2503MCL | Recombinant Mouse F3 cell lysate | +Inquiry |
F3-1256RCL | Recombinant Rat F3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All F3 Products
Required fields are marked with *
My Review for All F3 Products
Required fields are marked with *
0
Inquiry Basket