Recombinant Mouse Efnb2 Protein, His-tagged

Cat.No. : Efnb2-7194M
Product Overview : Recombinant Mouse Efnb2 protein with a His tag was expressed in insect cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Insect Cells
Tag : His
Protein Length : 29-232
Description : Cell surface transmembrane ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Binds to receptor tyrosine kinase including EPHA4, EPHA3 and EPHB4. Together with EPHB4 plays a central role in heart morphogenesis and angiogenesis through regulation of cell adhesion and cell migration. EPHB4-mediated forward signaling controls cellular repulsion and segregation from EFNB2-expressing cells. May play a role in constraining the orientation of longitudinally projecting axons.
Form : Liquid
Molecular Mass : 23.4 kDa
AA Sequence : RSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCARPDQDVKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSARNHGPTRRPELEAGTNGRSSTTSPFVKPNPGSSTDGNSAGHSGNNLLGSEVALFALEHHHHHH
Endotoxin : < 1.0 EU/μg of protein (determined by LAL method)
Purity : > 90 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration : 0.5 mg/mL (determined by absorbance at 280nm)
Storage Buffer : Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol.
Gene Name Efnb2 ephrin B2 [ Mus musculus (house mouse) ]
Official Symbol Efnb2
Synonyms Efnb2; ephrin B2; Ep; Epl; Ler; ELF-; Epl5; Htk-; LERK; NLER; ELF-2; Eplg5; Htk-L; Lerk5; LERK-5; NLERK-1; ephrin-B2; EPH-related receptor tyrosine kinase ligand 5; HTK ligand
Gene ID 13642
mRNA Refseq NM_010111
Protein Refseq NP_034241
UniProt ID P52800

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Efnb2 Products

Required fields are marked with *

My Review for All Efnb2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon