Recombinant Mouse DEFB33 Protein (21-62 aa), His-SUMO-Myc-tagged
| Cat.No. : | DEFB33-2620M |
| Product Overview : | Recombinant Mouse DEFB33 Protein (21-62 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Source : | E. coli |
| Species : | Mouse |
| Tag : | His&Myc&SUMO |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 24.9 kDa |
| Protein length : | 21-62 aa |
| AA Sequence : | RKRNSKFRPCEKMGGICKSQKTHGCSILPAECKSRYKHCCRL |
| Purity : | > 85% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | Defb33 defensin beta 33 [ Mus musculus (house mouse) ] |
| Official Symbol | DEFB33 |
| Synonyms | Defb33; BD-33; EG654453; |
| Gene ID | 654453 |
| mRNA Refseq | NM_001039119 |
| Protein Refseq | NP_001034208 |
| UniProt ID | Q30KN3 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DEFB33 Products
Required fields are marked with *
My Review for All DEFB33 Products
Required fields are marked with *
0
Inquiry Basket
