Recombinant Mouse DEFB33 Protein (21-62 aa), His-SUMO-Myc-tagged
Cat.No. : | DEFB33-2620M |
Product Overview : | Recombinant Mouse DEFB33 Protein (21-62 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 21-62 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 24.9 kDa |
AA Sequence : | RKRNSKFRPCEKMGGICKSQKTHGCSILPAECKSRYKHCCRL |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Defb33 defensin beta 33 [ Mus musculus (house mouse) ] |
Official Symbol | DEFB33 |
Synonyms | Defb33; BD-33; EG654453; |
Gene ID | 654453 |
mRNA Refseq | NM_001039119 |
Protein Refseq | NP_001034208 |
UniProt ID | Q30KN3 |
◆ Recombinant Proteins | ||
DEFB33-1835R | Recombinant Rat DEFB33 Protein | +Inquiry |
DEFB33-1493R | Recombinant Rat DEFB33 Protein, His (Fc)-Avi-tagged | +Inquiry |
DEFB33-2620M | Recombinant Mouse DEFB33 Protein (21-62 aa), His-SUMO-Myc-tagged | +Inquiry |
DEFB33-4479M | Recombinant Mouse DEFB33 Protein | +Inquiry |
DEFB33-2309M | Recombinant Mouse DEFB33 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DEFB33 Products
Required fields are marked with *
My Review for All DEFB33 Products
Required fields are marked with *
0
Inquiry Basket