Recombinant Mouse DCN Protein (35-354 aa), His-tagged
| Cat.No. : | DCN-1377M |
| Product Overview : | Recombinant Mouse DCN Protein (35-354 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | May affect the rate of fibrils formation. |
| Source : | Yeast |
| Species : | Mouse |
| Tag : | His |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 37.9 kDa |
| Protein length : | 35-354 aa |
| AA Sequence : | GIIPYDPDNPLISMCPYRCQCHLRVVQCSDLGLDKVPWDFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNQLKELPEKMPRTLQELRVHENEITKLRKSDFNGLNNVLVIELGGNPLKNSGIENGAFQGLKSLSYIRISDTNITAIPQGLPTSLTEVHLDGNKITKVDAPSLKGLINLSKLGLSFNSITVMENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYIQVVYLHNNNISAVGQNDFCRAGHPSRKASYSAVSLYGNPVRYWEIFPNTFRCVYVRSAIQLGNYK |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | Dcn decorin [ Mus musculus ] |
| Official Symbol | DCN |
| Synonyms | DCN; decorin; DC; PG40; PGII; PGS2; mDcn; DSPG2; SLRR1B; |
| Gene ID | 13179 |
| mRNA Refseq | NM_001190451 |
| Protein Refseq | NP_001177380 |
| UniProt ID | P28654 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DCN Products
Required fields are marked with *
My Review for All DCN Products
Required fields are marked with *
0
Inquiry Basket
