Recombinant Mouse DBIL5 Protein (1-87 aa), His-tagged

• Cat.No.: DBIL5-2426M
• Product Overview: Recombinant Mouse DBIL5 Protein (1-87 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length.

Specification

• Description: May be involved in the energy metabolism of the mature sperm.
• Source: E. coli
• Species: Mouse
• Tag: His
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 13.9 kDa
• Protein length: 1-87 aa
• AA Sequence: MSQVEFEMACASLKQLKGPVSDQEKLLVYSFYKQATQGDCNIPVPPATDVRAKAKYEAWMVNKGMSKMDAMRIYIAKVEELKKKEPC
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Dbil5 diazepam binding inhibitor-like 5 [ Mus musculus (house mouse) ]
• Official Symbol: DBIL5
• Synonyms: Dbil5; ELP
• Gene ID: 13168
• mRNA Refseq: NM_021294
• Protein Refseq: NP_067269
• UniProt ID: O09035