Recombinant Mouse DBIL5 Protein (1-87 aa), His-tagged
Cat.No. : | DBIL5-2426M |
Product Overview : | Recombinant Mouse DBIL5 Protein (1-87 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-87 aa |
Description : | May be involved in the energy metabolism of the mature sperm. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 13.9 kDa |
AA Sequence : | MSQVEFEMACASLKQLKGPVSDQEKLLVYSFYKQATQGDCNIPVPPATDVRAKAKYEAWMVNKGMSKMDAMRIYIAKVEELKKKEPC |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Dbil5 diazepam binding inhibitor-like 5 [ Mus musculus (house mouse) ] |
Official Symbol | DBIL5 |
Synonyms | Dbil5; ELP; |
Gene ID | 13168 |
mRNA Refseq | NM_021294 |
Protein Refseq | NP_067269 |
UniProt ID | O09035 |
◆ Recombinant Proteins | ||
DBIL5-4318M | Recombinant Mouse DBIL5 Protein | +Inquiry |
DBIL5-1780R | Recombinant Rat DBIL5 Protein | +Inquiry |
DBIL5-1438R | Recombinant Rat DBIL5 Protein, His (Fc)-Avi-tagged | +Inquiry |
DBIL5-2209M | Recombinant Mouse DBIL5 Protein, His (Fc)-Avi-tagged | +Inquiry |
DBIL5-2426M | Recombinant Mouse DBIL5 Protein (1-87 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DBIL5 Products
Required fields are marked with *
My Review for All DBIL5 Products
Required fields are marked with *
0
Inquiry Basket