Recombinant Mouse Cxcl3 protein

Cat.No. : Cxcl3-610M
Product Overview : Recombinant Mouse Cxcl3 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : CXCL3, also known as DCIP1 in murine, CINC2 in rat, and GROγ in humans, is belonging to the CXC chemokine family. It is encoded by the gene CXCL3 in mouse. The functional receptor for CXCL3 has been identified as CXCR2. Similar to other GRO proteins, CXCL3 is potent neutrophil attractants and activators. CXCL3 plays a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. The amino acid sequence of murine CXCL3 is 57 % identical to human CXCL3.
Source : E.coli
Species : Mouse
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human CXCR2 transfected human 293 cells is in a concentration range of 10-100 ng/ml.
Molecular Mass : Approximately 7.9 kDa, a single, non-glycosylated polypeptide chain containing 73 amino acids.
Protein length : 73
AA Sequence : AVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS
Endotoxin : Less than 1 EU/μg of rMuDCIP-1/CXCL3 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Tag : Non
Gene Name Cxcl3
Official Symbol Cxcl3
Synonyms CXCL3; chemokine (C-X-C motif) ligand 3; C-X-C motif chemokine 3; dendritic cell inflammatory protein 1; Dcip1; Gm1960;
Gene ID 330122
mRNA Refseq NM_203320
Protein Refseq NP_976065
UniProt ID Q6W5C0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Cxcl3 Products

Required fields are marked with *

My Review for All Cxcl3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon