Active Recombinant Human CXCL12 Protein

• Cat.No.: CXCL12-13H
• Product Overview: Recombinant Human CXCL12 Protein without tag was expressed in E. coli.

Specification

• Description: This antimicrobial gene encodes a stromal cell-derived alpha chemokine member of the intercrine family. The encoded protein functions as the ligand for the G-protein coupled receptor, chemokine (C-X-C motif) receptor 4, and plays a role in many diverse cellular functions, including embryogenesis, immune surveillance, inflammation response, tissue homeostasis, and tumor growth and metastasis. Mutations in this gene are associated with resistance to human immunodeficiency virus type 1 infections. Multiple transcript variants encoding different isoforms have been found for this gene.
• Source: E. coli
• Species: Human
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Fully biologically active when compared to standard. Determined by its ability to chemoattract human peripheral T cells activated with PHA and IL-2 using a concentration range of 20.0-80.0 ng/mL, corresponding to a Specific Activity of ＞1.25 × 10^4 IU/mg.
• Molecular Mass: 8.0 kDa, a single non-glycosylated polypeptide chain containing 68 amino acids.
• Protein length: 68 amino acids
• AA Sequence: KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
• Endotoxin: Less than 1 EU/μg of rHuSDF-1 alpha as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 or -70 centigrade. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Lyophilized from a 0.2μm filtered concentrated solution in 20mM PB, pH 130mM NaCl.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: CXCL12 C-X-C motif chemokine ligand 12 [ Homo sapiens (human) ]
• Official Symbol: CXCL12
• Synonyms: CXCL12; C-X-C motif chemokine ligand 12; IRH; PBSF; SDF1; TLSF; TPAR1; SCYB12; stromal cell-derived factor 1; chemokine (C-X-C motif) ligand 12; intercrine reduced in hepatomas; pre-B cell growth-stimulating factor
• Gene ID: 6387
• mRNA Refseq: NM_000609
• Protein Refseq: NP_000600
• MIM: 600835
• UniProt ID: P48061