Recombinant Mouse CXCL12 protein

• Cat.No.: CXCL12-21M
• Product Overview: Recombinant Mouse CXCL12 beta protein was expressed in Escherichia coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• Protein Length: 72
• Description: CXCL12 also known as SDF-1 is belonging to the CXC chemokine family. Murine CXCL12 is expressed as two isoforms that differ only in the C-terminal tail. Both SDF-1 isoforms undergo proteolytic processing of the first two N-terminal amino acids. In all SDF-1 isoforms, SDF-1β is the canonical sequence. It has the complete amino acids in the C-terminal tail. On the cell surface, the receptor for this chemokine is CXCR4 and syndecan4. CXCL12 is strongly chemotactic for T-lymphocytes, monocytes, but not neutrophils. SDF-1 is highly conserved between species, murine CXCL12β shares approximately 92 % amino acid sequence identity with human CXCL12β.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 150 mM NaCl.
• Bio-activity: Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood monocytes is in a concentration range of 50-100 ng/ml.
• Molecular Mass: Approximately 8.5 kDa, a single non-glycosylated polypeptide chain containing 72 amino acids.
• AA Sequence: KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRLKM
• Endotoxin: Less than 1 EU/μg of rMuSDF-1β/CXCL12βas determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: CXCL12
• Official Symbol: CXCL12
• Synonyms: CXCL12; chemokine (C-X-C motif) ligand 12; stromal cell-derived factor 1; C-X-C motif chemokine 12; pre-B cell growth-stimulating factor; pre-B-cell growth-stimulating factor; thymic lymphoma cell-stimulating factor; 12-O-tetradecanoylphorbol 13-acetate repressed protein 1; Pbsf; Sdf1; Tlsf; Sdf1a; Sdf1b; Tlsfa; Tlsfb; Tpar1; Scyb12; AI174028
• Gene ID: 20315
• mRNA Refseq: NM_001012477
• Protein Refseq: NP_001012495
• UniProt ID: P40224