Recombinant Mouse Ctsl Protein, His-tagged

• Cat.No.: Ctsl-7187M
• Product Overview: Recombinant Mouse Ctsl Protein with a His tag.

Specification

• Species: Mouse
• Tag: His
• Protein Length: 18-334
• Description: This gene encodes a member of the peptidase C1 (papain) family of cysteine proteases. The encoded preproprotein is proteolytically processed to generate multiple protein products. These products include the activation peptide and the cathepsin L1 heavy and light chains. The mature enzyme appears to be important in embryonic development through its processing of histone H3 and may play a role in disease progression in a model of kidney disease. Homozygous knockout mice for this gene exhibit hair loss, skin thickening, bone and heart defects, and enhanced susceptibility to bacterial infection. A pseudogene of this gene has been identified in the genome.
• Form: Liquid
• Molecular Mass: 36.8 kDa
• AA Sequence: TPKFDQTFSAEWHQWKSTHRRLYGTNEEEWRRAIWEKNMRMIQLHNGEYSNGQHGFSMEMNAFGDMTNEEFRQVVNGYRHQKHKKGRLFQEPLMLKIPKSVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGTDSNKNKYWLVKNSWGSEWGMEGYIKIAKDRDNHCGLATAASYPVVNLEHHHHHH
• Endotoxin: < 1.0 EU/μg of protein (determined by LAL method)
• Purity: > 90 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 0.25 mg/mL (determined by absorbance at 280nm)
• Storage Buffer: Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol.

Gene Information

• Gene Name: Ctsl cathepsin L [ Mus musculus (house mouse) ]
• Official Symbol: Ctsl
• Synonyms: Ctsl; cathepsin L; ME; fs; MEP; nkt; CatL; Ctsl1; 1190035F06Rik; procathepsin L; cathepsin L1; Cat L; major excreted protein; p39 cysteine proteinase; EC 3.4.22.15
• Gene ID: 13039
• mRNA Refseq: NM_009984
• Protein Refseq: NP_034114
• UniProt ID: P06797