Recombinant Mouse Ctsd Protein, His-tagged

• Cat.No.: Ctsd-2369M
• Product Overview: Purified recombinant protein of Mouse cathepsin D (Ctsd) with a C-His tag was expressed in HEK293.

Specification

• Description: Acid protease active in intracellular protein breakdown. Plays a role in APP processing following cleavage and activation by ADAM30 which leads to APP degradation.
• Source: HEK293
• Species: Mouse
• Tag: His
• Molecular Mass: 43.9 kDa
• AA Sequence: IIRIPLRKFTSIRRTMTEVGGSVEDLILKGPITKYSMQSSPKTTEPVSELLKNYLDAQYYGDIGIGTPPQCFTVVFDTGSSNLWVPSIHCKILDIACWVHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSDQSKARGIKVEKQIFGEATKQPGIVFVAAKFDGILGMGYPHISVNNVLPVFDNLMQQKLVDKNIFSFYLNRDPEGQPGGELMLGGTDSKYYHGELSYLNVTRKAYWQVHMDQLEVGNELTLCKGGCEAIVDTGTSLLVGPVEEVKELQKAIGAVPLIQGEYMIPCEKVSSLPTVYLKLGGKNYELHPDKYILKVSQGGKTICLSGFMGMDIPPPSGPLWILGDVFIGSYYTVFDRDNNRVGFANAVVLVDHHHHHH
• Endotoxin: < 0.1 ng/μg of protein (< 1 EU/μg)
• Purity: > 95% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: LyopH ilized from a 0.2 μM filtered solution of 20 mM MES, 150 mM NaCl, pH 5.5
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/mL. Dissolve the lyophilized protein in 1×PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: Ctsd cathepsin D [ Mus musculus (house mouse) ]
• Official Symbol: Ctsd
• Synonyms: CTSD; cathepsin D; CD; CatD
• Gene ID: 13033
• mRNA Refseq: NM_009983
• Protein Refseq: NP_034113
• UniProt ID: P18242