Recombinant Mouse Ctla4 Protein, hIgG-His-tagged

• Cat.No.: Ctla4-7168M
• Product Overview: Recombinant Mouse Ctla4 Protein with hIgG-His tag.

Specification

• Species: Mouse
• Tag: Fc&His
• Protein Length: 38-161
• Description: This gene is a member of the immunoglobulin superfamily, and encodes a protein that functions as a negative regulator of T-cell responses. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
• Form: Liquid
• Molecular Mass: 40.6 kDa
• AA Sequence: IQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
• Endotoxin: < 1.0 EU/μg of protein (determined by LAL method)
• Purity: > 90 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 0.5 mg/mL (determined by absorbance at 280nm)
• Storage Buffer: Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol.

Gene Information

• Gene Name: Ctla4 cytotoxic T-lymphocyte-associated protein 4 [ Mus musculus (house mouse) ]
• Official Symbol: Ctla4
• Synonyms: Ctla4; cytotoxic T-lymphocyte-associated protein 4; Ctla; Ly-5; Cd152; Ly-56; Ctla-4; cytotoxic T-lymphocyte protein 4; CD152 antigen; cytotoxic T-lymphocyte-associated antigen 4
• Gene ID: 12477
• mRNA Refseq: NM_001281976
• Protein Refseq: NP_001268905
• UniProt ID: Q5SSM0