Recombinant Human Ctla4 Protein
Cat.No. : | Ctla4-649H |
Product Overview : | Recombinant human Ctla4 protein without tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Protein Length : | 223 |
Description : | This gene is a member of the immunoglobulin superfamily and encodes a protein which transmits an inhibitory signal to T cells. The protein contains a V domain, a transmembrane domain, and a cytoplasmic tail. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. The membrane-bound isoform functions as a homodimer interconnected by a disulfide bond, while the soluble isoform functions as a monomer. Mutations in this gene have been associated with insulin-dependent diabetes mellitus, Graves disease, Hashimoto thyroiditis, celiac disease, systemic lupus erythematosus, thyroid-associated orbitopathy, and other autoimmune diseases. |
Form : | Lyophilized |
Molecular Mass : | 14.3 kDa |
AA Sequence : | MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | CTLA4 cytotoxic T-lymphocyte-associated protein 4 [ Homo sapiens (human) ] |
Official Symbol | Ctla4 |
Synonyms | CTLA4; cytotoxic T-lymphocyte-associated protein 4; celiac disease 3 , CELIAC3; cytotoxic T-lymphocyte protein 4; CD; CD28; CD152; GSE; ICOS; CD152 isoform; celiac disease 3; cytotoxic T-lymphocyte antigen 4; cytotoxic T-lymphocyte-associated antigen 4; cytotoxic T-lymphocyte-associated serine esterase-4; cytotoxic T lymphocyte associated antigen 4 short spliced form; ligand and transmembrane spliced cytotoxic T lymphocyte associated antigen 4; GRD4; CTLA-4; IDDM12; CELIAC3; |
Gene ID | 1493 |
mRNA Refseq | NM_001037631 |
Protein Refseq | NP_001032720 |
MIM | 123890 |
UniProt ID | P16410 |
◆ Recombinant Proteins | ||
Ctla4-3307MF | Recombinant Mouse Ctla4 Protein, His-tagged, FITC conjugated | +Inquiry |
CTLA4-232H | Recombinant Human cytotoxic T-lymphocyte associated protein 4 Protein, His tagged | +Inquiry |
CTLA4-2234H | Recombinant Human CTLA4 protein, Fc-tagged | +Inquiry |
CTLA4-3536H | Recombinant Human CTLA4 protein, Twin-Strep-tagged | +Inquiry |
CTLA4-1061CAF647 | Recombinant Canine CTLA4 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTLA4-2179MCL | Recombinant Mouse CTLA4 cell lysate | +Inquiry |
CTLA4-1047CCL | Recombinant Cynomolgus CTLA4 cell lysate | +Inquiry |
CTLA4-2526HCL | Recombinant Human CTLA4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ctla4 Products
Required fields are marked with *
My Review for All Ctla4 Products
Required fields are marked with *
0
Inquiry Basket