Recombinant Human Ctla4 Protein

• Cat.No.: Ctla4-649H
• Product Overview: Recombinant human Ctla4 protein without tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Protein Length: 223
• Description: This gene is a member of the immunoglobulin superfamily and encodes a protein which transmits an inhibitory signal to T cells. The protein contains a V domain, a transmembrane domain, and a cytoplasmic tail. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. The membrane-bound isoform functions as a homodimer interconnected by a disulfide bond, while the soluble isoform functions as a monomer. Mutations in this gene have been associated with insulin-dependent diabetes mellitus, Graves disease, Hashimoto thyroiditis, celiac disease, systemic lupus erythematosus, thyroid-associated orbitopathy, and other autoimmune diseases.
• Form: Lyophilized
• Molecular Mass: 14.3 kDa
• AA Sequence: MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: CTLA4 cytotoxic T-lymphocyte-associated protein 4 [ Homo sapiens (human) ]
• Official Symbol: Ctla4
• Synonyms: CTLA4; cytotoxic T-lymphocyte-associated protein 4; celiac disease 3 , CELIAC3; cytotoxic T-lymphocyte protein 4; CD; CD28; CD152; GSE; ICOS; CD152 isoform; celiac disease 3; cytotoxic T-lymphocyte antigen 4; cytotoxic T-lymphocyte-associated antigen 4; cytotoxic T-lymphocyte-associated serine esterase-4; cytotoxic T lymphocyte associated antigen 4 short spliced form; ligand and transmembrane spliced cytotoxic T lymphocyte associated antigen 4; GRD4; CTLA-4; IDDM12; CELIAC3
• Gene ID: 1493
• mRNA Refseq: NM_001037631
• Protein Refseq: NP_001032720
• MIM: 123890
• UniProt ID: P16410