Recombinant Mouse Csf3 protein

• Cat.No.: Csf3-100M
• Product Overview: Recombinant Mouse Csf3 protein was expressed in Escherichia coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• Protein Length: 178
• Description: The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes. The active protein is found extracellularly. Alternatively spliced transcript variants have been described for this gene.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 10 mM Sodium Citrate, pH 4.0, 150 mM NaCl, 0.01 % Tween-20.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine NFS-60 cells is less than 0.05 ng/ml, corresponding to a specific activity of > 2.0 × 10⁷ IU/mg.
• Molecular Mass: Approximately 18.9 kDa, a single non-glycosylated polypeptide chain containing 178 amino acids.
• AA Sequence: VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA
• Endotoxin: Less than 0.1 EU/μg of rMuG-CSF as determined by LAL method.
• Purity: >98% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Csf3
• Official Symbol: Csf3
• Synonyms: CSF3; colony stimulating factor 3 (granulocyte); granulocyte colony-stimulating factor; Csfg; G-CSF; MGI-IG
• Gene ID: 12985
• mRNA Refseq: NM_009971
• Protein Refseq: NP_034101
• UniProt ID: P09920