Recombinant Mouse Csf2 Protein

• Cat.No.: Csf2-7177M
• Product Overview: Mouse recombinant GM-CSF (aa. 125) protein without tag was expressed in E. coli.

Specification

• Description: Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.
• Form: Lyophilized
• Molecular Mass: 14,24 kDa
• AA Sequence: MAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK
• Endotoxin: < 0.1 ng/μg of GM-CSF
• Purity: > 95 % by SDS-PAGE and Silver staining
• Stability: Shelf life: one year from despatch.
• Storage: The lyophilized antibody can be stored at room temperature for up to two weeks, or desiccated at -20 centigrade for longer. Following reconstitution store in aliquots at -20 centigrade. Avoid repeated freezing and thawing.
• Storage Buffer: 50 mM acetic acid without stabilizer
• Reconstitution: Mouse GM-CSF should be reconstituted in 50 mM acetic acid or water to a concentration of 0.1 mg/mL. This solution can be diluted in water or other buffer solutions.

Gene Information

• Gene Name: Csf2 colony stimulating factor 2 (granulocyte-macrophage) [ Mus musculus (house mouse) ]
• Official Symbol: Csf2
• Synonyms: Csf2; colony stimulating factor 2 (granulocyte-macrophage); CSF; Csfg; GMCS; Csfgm; GMCSF; Gm-CS; MGI-I; Gm-CSf; MGI-IGM; granulocyte-macrophage colony-stimulating factor; colony-stimulating factor; granulocyte-macrophage colony stimulating factor 2; put. GM-CSF
• Gene ID: 12981
• mRNA Refseq: NM_009969
• Protein Refseq: NP_034099
• UniProt ID: P01587