Recombinant Mouse Csf2 Protein

Cat.No. : Csf2-7177M
Product Overview : Mouse recombinant GM-CSF (aa. 125) protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.
Form : Lyophilized
Molecular Mass : 14,24 kDa
AA Sequence : MAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK
Endotoxin : < 0.1 ng/μg of GM-CSF
Purity : > 95 % by SDS-PAGE and Silver staining
Stability : Shelf life: one year from despatch.
Storage : The lyophilized antibody can be stored at room temperature for up to two weeks, or desiccated at -20 centigrade for longer. Following reconstitution store in aliquots at -20 centigrade. Avoid repeated freezing and thawing.
Storage Buffer : 50 mM acetic acid without stabilizer
Reconstitution : Mouse GM-CSF should be reconstituted in 50 mM acetic acid or water to a concentration of 0.1 mg/mL. This solution can be diluted in water or other buffer solutions.
Gene Name Csf2 colony stimulating factor 2 (granulocyte-macrophage) [ Mus musculus (house mouse) ]
Official Symbol Csf2
Synonyms Csf2; colony stimulating factor 2 (granulocyte-macrophage); CSF; Csfg; GMCS; Csfgm; GMCSF; Gm-CS; MGI-I; Gm-CSf; MGI-IGM; granulocyte-macrophage colony-stimulating factor; colony-stimulating factor; granulocyte-macrophage colony stimulating factor 2; put. GM-CSF
Gene ID 12981
mRNA Refseq NM_009969
Protein Refseq NP_034099
UniProt ID P01587

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Csf2 Products

Required fields are marked with *

My Review for All Csf2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon