Recombinant Mouse Csf2 Protein
Cat.No. : | Csf2-7177M |
Product Overview : | Mouse recombinant GM-CSF (aa. 125) protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. |
Form : | Lyophilized |
Molecular Mass : | 14,24 kDa |
AA Sequence : | MAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK |
Endotoxin : | < 0.1 ng/μg of GM-CSF |
Purity : | > 95 % by SDS-PAGE and Silver staining |
Stability : | Shelf life: one year from despatch. |
Storage : | The lyophilized antibody can be stored at room temperature for up to two weeks, or desiccated at -20 centigrade for longer. Following reconstitution store in aliquots at -20 centigrade. Avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM acetic acid without stabilizer |
Reconstitution : | Mouse GM-CSF should be reconstituted in 50 mM acetic acid or water to a concentration of 0.1 mg/mL. This solution can be diluted in water or other buffer solutions. |
Gene Name | Csf2 colony stimulating factor 2 (granulocyte-macrophage) [ Mus musculus (house mouse) ] |
Official Symbol | Csf2 |
Synonyms | Csf2; colony stimulating factor 2 (granulocyte-macrophage); CSF; Csfg; GMCS; Csfgm; GMCSF; Gm-CS; MGI-I; Gm-CSf; MGI-IGM; granulocyte-macrophage colony-stimulating factor; colony-stimulating factor; granulocyte-macrophage colony stimulating factor 2; put. GM-CSF |
Gene ID | 12981 |
mRNA Refseq | NM_009969 |
Protein Refseq | NP_034099 |
UniProt ID | P01587 |
◆ Recombinant Proteins | ||
Csf2-609M | Active Recombinant Mouse Csf2 Protein | +Inquiry |
CSF2-85H | Recombinant Human GMCSF, His-tagged | +Inquiry |
CSF2-116C | Active Recombinant Human CSF2 Protein (128 aa) | +Inquiry |
CSF2-515H | Recombinant Human CSF2 protein | +Inquiry |
GM-CSF-368E | Recombinant Equine GM-CSF | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF2-3008HCL | Recombinant Human CSF2 cell lysate | +Inquiry |
CSF2-1008MCL | Recombinant Mouse CSF2 cell lysate | +Inquiry |
CSF2-740RCL | Recombinant Rat CSF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Csf2 Products
Required fields are marked with *
My Review for All Csf2 Products
Required fields are marked with *
0
Inquiry Basket