Recombinant Mouse Csf1r Protein, GST-tagged

• Cat.No.: Csf1r-1966M
• Product Overview: Mouse Csf1r partial ORF (NP_001032948.2, 133 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Protein tyrosine-kinase transmembrane receptor for CSF1 and IL34.
• Source: Wheat Germ
• Species: Mouse
• Tag: GST
• Molecular Mass: 37.62 kDa
• AA Sequence: ALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: Csf1r colony stimulating factor 1 receptor [ Mus musculus ]
• Official Symbol: Csf1r
• Synonyms: CSF1R; colony stimulating factor 1 receptor; macrophage colony-stimulating factor 1 receptor; c-fms; CSF-1-R; CSF-1 receptor; proto-oncogene fms; proto-oncogene c-Fms; Fms; CD115; Csfmr; Fim-2; CSF-1R; M-CSFR; M-CSF-R; AI323359
• Gene ID: 12978
• mRNA Refseq: NM_001037859
• Protein Refseq: NP_001032948