Recombinant Human CSF1R Protein, GST-tagged
Cat.No. : | CSF1R-1965H |
Product Overview : | Human CSF1R partial ORF ( AAH47521, 21 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is the receptor for colony stimulating factor 1, a cytokine which controls the production, differentiation, and function of macrophages. This receptor mediates most if not all of the biological effects of this cytokine. Ligand binding activates the receptor kinase through a process of oligomerization and transphosphorylation. The encoded protein is a tyrosine kinase transmembrane receptor and member of the CSF1/PDGF receptor family of tyrosine-protein kinases. Mutations in this gene have been associated with a predisposition to myeloid malignancy. The first intron of this gene contains a transcriptionally inactive ribosomal protein L7 processed pseudogene oriented in the opposite direction. Alternative splicing results in multiple transcript variants. Expression of a splice variant from an LTR promoter has been found in Hodgkin lymphoma (HL), HL cell lines and anaplastic large cell lymphoma. [provided by RefSeq, Mar 2017] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | PVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTLYSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFED |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CSF1R colony stimulating factor 1 receptor [ Homo sapiens ] |
Official Symbol | CSF1R |
Synonyms | CSF1R; colony stimulating factor 1 receptor; FMS, McDonough feline sarcoma viral (v fms) oncogene homolog; macrophage colony-stimulating factor 1 receptor; C FMS; CD115; CSFR; CSF-1-R; CD115 antigen; CSF-1 receptor; FMS proto-oncogene; proto-oncogene c-Fms; macrophage colony stimulating factor I receptor; McDonough feline sarcoma viral (v-fms) oncogene homolog; FMS; FIM2; HDLS; C-FMS; CSF-1R; M-CSF-R; |
Gene ID | 1436 |
mRNA Refseq | NM_005211 |
Protein Refseq | NP_005202 |
MIM | 164770 |
UniProt ID | P07333 |
◆ Recombinant Proteins | ||
CSF1R-0510C | Active Recombinant Cynomolgus CSF1R protein, Fc-tagged | +Inquiry |
CSF1R-1085HFL | Recombinant Full Length Human CSF1R Protein, C-Flag-tagged | +Inquiry |
CSF1R-979R | Recombinant Rhesus CSF1R Protein (Met1-Glu512) (Cys378Arg), HlgG1 Fc-tagged | +Inquiry |
CSF1R-1826H | Recombinant Human CSF1R Protein (20-512), His tagged | +Inquiry |
CSF1R-1268H | Active Recombinant Human CSF1R protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF1R-2739HCL | Recombinant Human CSF1R cell lysate | +Inquiry |
CSF1R-444HCL | Recombinant Human CSF1R cell lysate | +Inquiry |
CSF1R-2091MCL | Recombinant Mouse CSF1R cell lysate | +Inquiry |
CSF1R-823RCL | Recombinant Rat CSF1R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CSF1R Products
Required fields are marked with *
My Review for All CSF1R Products
Required fields are marked with *
0
Inquiry Basket