Recombinant Mouse Cox5a protein, His-SUMO&Myc-tagged

Cat.No. : Cox5a-6544M
Product Overview : Recombinant Mouse Cox5a protein(P12787)(38-146aa), fused with N-terminal His tag and SUMO tag and C-terminal Myc tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&Myc&SUMO
Protein Length : 38-146aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 25.4 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : SHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Gene Name Cox5a cytochrome c oxidase, subunit Va [ Mus musculus ]
Official Symbol Cox5a
Synonyms COX5A; cytochrome c oxidase, subunit Va; cytochrome c oxidase subunit 5A, mitochondrial; cytochrome c oxidase polypeptide Va; CcOX; AA959768;
Gene ID 12858
mRNA Refseq NM_007747
Protein Refseq NP_031773

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Cox5a Products

Required fields are marked with *

My Review for All Cox5a Products

Required fields are marked with *

0

Inquiry Basket

cartIcon