Recombinant Mouse Col4a3 protein, His&Myc-tagged

• Cat.No.: Col4a3-646M
• Product Overview: Recombinant Mouse Col4a3 protein(Q9QZS0)(1424-1669aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&Myc
• Protein Length: 1424-1669aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 34.4 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: PGLKGNPGDRGTPATGTRMRGFIFTRHSQTTAIPSCPEGTQPLYSGFSLLFVQGNKRAHGQDLGTLGSCLQRFTTMPFLFCNINNVCNFASRNDYSYWLSTPALMPMDMAPISGRALEPYISRCTVCEGPAMAIAVHSQTTAIPPCPQDWVSLWKGFSFIMFTSAGSEGAGQALASPGSCLEEFRASPFIECHGRGTCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGDLEKIISRCQVCMKKRH

Gene Information

• Gene Name: Col4a3 collagen, type IV, alpha 3 [ Mus musculus ]
• Official Symbol: Col4a3
• Synonyms: COL4A3; collagen, type IV, alpha 3; collagen alpha-3(IV) chain; tumstatin; collagen type IV alpha3 chain; procollagen, type IV, alpha 3; [a]3(IV); alpha3(IV)
• Gene ID: 12828
• mRNA Refseq: NM_007734
• Protein Refseq: NP_031760