Recombinant Mouse Col18a1 protein, H1591-K1774, C-6×His tagged

Cat.No. : Col18a1-12M
Product Overview : Collagen alpha-1 (XVIII) chain/COL18A1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Collagen alpha-1 (XVIII) chain/COL18A1 protein, expressed by HEK293, with C-6×His labeled tag. The total length of Collagen alpha-1 (XVIII) chain/COL18A1 Protein, Mouse (HEK293, His) is 184 AA.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Tag : His
Protein Length : H1591-K1774
Description : Predicted to enable identical protein binding activity. Predicted to be an extracellular matrix structural constituent. Acts upstream of or within several processes, including angiogenesis; endothelial cell morphogenesis; and positive regulation of endothelial cell apoptotic process. Located in basement membrane. Is expressed in several structures, including alimentary system; brain; genitourinary system; respiratory system; and sensory organ. Used to study pigment dispersion syndrome. Human ortholog(s) of this gene implicated in primary angle-closure glaucoma. Orthologous to human COL18A1 (collagen type XVIII alpha 1 chain).
Form : Lyophilized powder
Molecular Mass : Approximately 18.0 kDa
AA Sequence : HTHQDFQPVLHLVALNTPLSGGMRGIRGADFQCFQQARAVGLSGTFRAFLSSRLQDLYSIVRRADRGSVPIVNLKDEVLSPSWDSLFSGSQGQLQPGARIFSFDGRDVLRHPAWPQKSVWHGSDPSGRRLMESYCETWRTETTGATGQASSLLSGRLLEQKAASCHNSYIVLCIENSFMTSFSK
Endotoxin : <1 EU/μg determined by LAL method.
Purity : > 95% by SDS-PAGE
Storage : Stored at -20 centigrade for 2 years. After reconstitution, it is stable at 4 centigrade for 1 week or -20 centigrade for longer (with carrier protein). It is recommended to freeze aliquots at -20 centigrade or -80 centigrade for extended storage.
Storage Buffer : Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Reconstitution : It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Gene Name Col18a1 collagen, type XVIII, alpha 1 [ Mus musculus (house mouse) ]
Official Symbol Col18a1
Synonyms Col18a1; collagen, type XVIII, alpha 1; collagen alpha-1(XVIII) chain; alpha-1(XVIII) collagen; endostatin; procollagen, type XVIII, alpha 1
Gene ID 12822
mRNA Refseq NM_009929
Protein Refseq NP_034059
UniProt ID P39061

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Col18a1 Products

Required fields are marked with *

My Review for All Col18a1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon