Recombinant Human COL18A1 Protein (1578-1754 aa), His-tagged
Cat.No. : | COL18A1-1367H |
Product Overview : | Recombinant Human COL18A1 Protein (1578-1754 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Adhesion. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1578-1754 aa |
Description : | COLA18A probably plays a major role in determining the retinal structure as well as in the closure of the neural tube.Endostatin potently inhibits endothelial cell proliferation and angiogenesis. May inhibit angiogenesis by binding to the heparan sulfate proteoglycans involved in growth factor signaling. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 21.3 kDa |
AA Sequence : | QPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFMTASK |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | COL18A1 collagen, type XVIII, alpha 1 [ Homo sapiens ] |
Official Symbol | COL18A1 |
Synonyms | COL18A1; KNO1; KS; KNO; FLJ27325; FLJ34914; MGC74745; |
Gene ID | 80781 |
mRNA Refseq | NM_030582 |
Protein Refseq | NP_085059 |
MIM | 120328 |
UniProt ID | P39060 |
◆ Recombinant Proteins | ||
COL18A1-2712H | Recombinant Human COL18A1 protein, GST-tagged | +Inquiry |
COL18A1-4986H | Recombinant Human Collagen, Type XVIII, Alpha 1 | +Inquiry |
Col18a1-204M | Recombinant Mouse Collagen, Type XVIII, Alpha 1 | +Inquiry |
COL18A1-28560TH | Recombinant Human COL18A1 | +Inquiry |
Col18a1-327M | Recombinant Mouse Col18a1 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COL18A1 Products
Required fields are marked with *
My Review for All COL18A1 Products
Required fields are marked with *
0
Inquiry Basket