Recombinant Mouse Cnot7 Protein, His-tagged
| Cat.No. : | Cnot7-7306M |
| Product Overview : | Recombinant mouse CNOT7 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | Has 3'-5' poly(A) exoribonuclease activity for synthetic poly(A) RNA substrate. Its function seems to be partially redundant with that of CNOT8. Catalytic component of the CCR4-NOT complex which is one of the major cellular mRNA deadenylases and is linked to various cellular processes including bulk mRNA degradation, miRNA-mediated repression, translational repression during translational initiation and general transcription regulation. During miRNA-mediated repression the complex seems also to act as translational repressor during translational initiation. Additional complex functions may be a consequence of its influence on mRNA expression. Required for miRNA-mediated mRNA deadenylation. Associates with members of the BTG family such as TOB1 and BTG2 and is required for their anti-proliferative activity. |
| Source : | E. coli |
| Species : | Mouse |
| Tag : | His |
| Form : | Liquid |
| Molecular Mass : | 31.1 kDa |
| Protein length : | 1-248 |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSMPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEASKQS |
| Purity : | > 80 % |
| Stability : | Shelf life: one year from despatch. |
| Storage : | Store undiluted at 2-8 centigrade for up to two weeks or (in aliquots) at -20 or -70 centigrade for longer. Avoid repeated freezing and thawing. |
| Concentration : | 1.0 mg/mL (determined by Bradford assay) |
| Storage Buffer : | 20 mM Tris-HCl buffer (pH 8.0) containing 20 % glycerol, 1 mM DTT |
| Gene Name | Cnot7 CCR4-NOT transcription complex, subunit 7 [ Mus musculus (house mouse) ] |
| Official Symbol | Cnot7 |
| Synonyms | Cnot7; CCR4-NOT transcription complex, subunit 7; Caf; Caf1; Pop2; CAF-1; AU022737; CCR4-NOT transcription complex subunit 7; CCR4-associated factor 1; POP2 homolog; catabolite repressor protein (CCR4)-associative factor 1; EC 3.1.13.4 |
| Gene ID | 18983 |
| mRNA Refseq | NM_001271542 |
| Protein Refseq | NP_001258471 |
| UniProt ID | Q60809 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cnot7 Products
Required fields are marked with *
My Review for All Cnot7 Products
Required fields are marked with *
0
Inquiry Basket
