Recombinant Mouse Cnot7 Protein, His-tagged

Cat.No. : Cnot7-7306M
Product Overview : Recombinant mouse CNOT7 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 1-248
Description : Has 3'-5' poly(A) exoribonuclease activity for synthetic poly(A) RNA substrate. Its function seems to be partially redundant with that of CNOT8. Catalytic component of the CCR4-NOT complex which is one of the major cellular mRNA deadenylases and is linked to various cellular processes including bulk mRNA degradation, miRNA-mediated repression, translational repression during translational initiation and general transcription regulation. During miRNA-mediated repression the complex seems also to act as translational repressor during translational initiation. Additional complex functions may be a consequence of its influence on mRNA expression. Required for miRNA-mediated mRNA deadenylation. Associates with members of the BTG family such as TOB1 and BTG2 and is required for their anti-proliferative activity.
Form : Liquid
Molecular Mass : 31.1 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSMPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEASKQS
Purity : > 80 %
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for up to two weeks or (in aliquots) at -20 or -70 centigrade for longer.
Avoid repeated freezing and thawing.
Concentration : 1.0 mg/mL (determined by Bradford assay)
Storage Buffer : 20 mM Tris-HCl buffer (pH 8.0) containing 20 % glycerol, 1 mM DTT
Gene Name Cnot7 CCR4-NOT transcription complex, subunit 7 [ Mus musculus (house mouse) ]
Official Symbol Cnot7
Synonyms Cnot7; CCR4-NOT transcription complex, subunit 7; Caf; Caf1; Pop2; CAF-1; AU022737; CCR4-NOT transcription complex subunit 7; CCR4-associated factor 1; POP2 homolog; catabolite repressor protein (CCR4)-associative factor 1; EC 3.1.13.4
Gene ID 18983
mRNA Refseq NM_001271542
Protein Refseq NP_001258471
UniProt ID Q60809

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Cnot7 Products

Required fields are marked with *

My Review for All Cnot7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon