Recombinant Mouse chemokine (C-C motif) receptor 2 Protein, His-tagged

Description :	Enables C-C chemokine binding activity and C-C chemokine receptor activity. Involved in several processes, including leukocyte migration; positive regulation of cell migration; and regulation of cytokine production. Acts upstream of or within several processes, including cellular defense response; monocyte chemotaxis; and neutrophil clearance. Located in external side of plasma membrane. Is expressed in several structures, including alimentary system; brain; genitourinary system; hemolymphoid system gland; and liver and biliary system. Used to study Coronavirus infectious disease and age related macular degeneration. Human ortholog(s) of this gene implicated in several diseases, including Kawasaki disease; aggressive periodontitis; coronary artery disease (multiple); glucose metabolism disease (multiple); and uveitis (multiple). Orthologous to human CCR2 (C-C motif chemokine receptor 2).
Source :	E. coli
Species :	Mouse
Tag :	N-10×His
Molecular Mass :	48.8 kDa
AA Sequence :	MEDNNMLPQFIHGILSTSHSLFTRSIQELDEGATTPYDYDDGEPCHKTSVKQIGAWILPPLYSLVFIFGFVGNMLVIIILIGCKKLKSMTDIYLLNLAISDLLFLLTLPFWAHYAANEWVFGNIMCKVFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVITSVVTWVVAVFASLPGIIFTKSKQDDHHYTCGPYFTQLWKNFQTIMRNILSLILPLLVMVICYSGILHTLFRCRNEKKRHRAVRLIFAIMIVYFLFWTPYNIVLFLTTFQESLGMSNCVIDKHLDQAMQVTETLGMTHCCINPVIYAFVGEKFRRYLSIFFRKHIAKRLCKQCPVFYRETADRVSSTFTPSTGEQEVSVGL
Purity :	> 90 % by SDS-PAGE
Storage :	Store it at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration :	0.4 mg/mL
Storage Buffer :	20 mM Tris-HCl, 0.15 M NaCl, 0.05 % FOS12, pH 8.0, 20 % glycerol

Gene Name	Ccr2 chemokine (C-C motif) receptor 2 [ Mus musculus (house mouse) ]
Official Symbol	Ccr2
Synonyms	CCR2; chemokine (C-C motif) receptor 2; C-C chemokine receptor type 2; CCR-2; C-C CKR-2; MIP-1 alphaR; MCP-1 receptor; JE/FIC receptor; chemokine (C-C) receptor 2; chemoattractant protein-1 receptor; C-C CHEMOKINE RECEPTOR TYPE 2 (C-C CKR-2) (CC-CKR-2) (CCR-2) (CCR2) (JE/FIC RECEPTOR) (MCP-1 RECEPTOR); Ckr2; Ccr2a; Ccr2b; Ckr2a; Ckr2b; mJe-r; Cmkbr2; Cc-ckr-2
Gene ID	12772
mRNA Refseq	NM_009915
Protein Refseq	NP_034045
UniProt ID	P51683