Recombinant Mouse Ccr2 protein, His&Myc-tagged
Cat.No. : | Ccr2-4321M |
Product Overview : | Recombinant Mouse Ccr2 protein(P51683)(1-55aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-55aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 13.6 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MEDNNMLPQFIHGILSTSHSLFTRSIQELDEGATTPYDYDDGEPCHKTSVKQIGA |
Gene Name | Ccr2 chemokine (C-C motif) receptor 2 [ Mus musculus ] |
Official Symbol | Ccr2 |
Synonyms | CCR2; chemokine (C-C motif) receptor 2; C-C chemokine receptor type 2; CCR-2; C-C CKR-2; MIP-1 alphaR; MCP-1 receptor; JE/FIC receptor; chemokine (C-C) receptor 2; chemoattractant protein-1 receptor; C-C CHEMOKINE RECEPTOR TYPE 2 (C-C CKR-2) (CC-CKR-2) (CCR-2) (CCR2) (JE/FIC RECEPTOR) (MCP-1 RECEPTOR); Ckr2; Ccr2a; Ccr2b; Ckr2a; Ckr2b; mJe-r; Cmkbr2; Cc-ckr-2; |
Gene ID | 12772 |
mRNA Refseq | NM_009915 |
Protein Refseq | NP_034045 |
◆ Recombinant Proteins | ||
CCR2-3014M | Recombinant Mouse chemokine (C-C motif) receptor 2 Protein, His-tagged | +Inquiry |
CCR2-27804TH | Recombinant Human CCR2 | +Inquiry |
CCR2-3494C | Recombinant Chicken CCR2 | +Inquiry |
CCR2-3954H | Active Recombinant Human CCR2 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
CCR2-1735HF | Recombinant Full Length Human CCR2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCR2-7696HCL | Recombinant Human CCR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ccr2 Products
Required fields are marked with *
My Review for All Ccr2 Products
Required fields are marked with *
0
Inquiry Basket