Recombinant Mouse Ccr2 protein, His&Myc-tagged

• Cat.No.: Ccr2-4321M
• Product Overview: Recombinant Mouse Ccr2 protein(P51683)(1-55aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&Myc
• Protein Length: 1-55aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 13.6 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: MEDNNMLPQFIHGILSTSHSLFTRSIQELDEGATTPYDYDDGEPCHKTSVKQIGA

Gene Information

• Gene Name: Ccr2 chemokine (C-C motif) receptor 2 [ Mus musculus ]
• Official Symbol: Ccr2
• Synonyms: CCR2; chemokine (C-C motif) receptor 2; C-C chemokine receptor type 2; CCR-2; C-C CKR-2; MIP-1 alphaR; MCP-1 receptor; JE/FIC receptor; chemokine (C-C) receptor 2; chemoattractant protein-1 receptor; C-C CHEMOKINE RECEPTOR TYPE 2 (C-C CKR-2) (CC-CKR-2) (CCR-2) (CCR2) (JE/FIC RECEPTOR) (MCP-1 RECEPTOR); Ckr2; Ccr2a; Ccr2b; Ckr2a; Ckr2b; mJe-r; Cmkbr2; Cc-ckr-2
• Gene ID: 12772
• mRNA Refseq: NM_009915
• Protein Refseq: NP_034045