Recombinant Mouse CD81 Protein (116-201 aa), GST-tagged
| Cat.No. : | CD81-400M |
| Product Overview : | Recombinant Mouse CD81 Protein (116-201 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | May play an important role in the regulation of lymphoma cell growth. May be involved in the acrosome reaction. |
| Source : | E. coli |
| Species : | Mouse |
| Tag : | GST |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 36.4 kDa |
| Protein length : | 116-201 aa |
| AA Sequence : | KDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNALTTLTTTILRNSLCPSGGNILTPLLQQDCHQKIDELFSGK |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | Cd81 CD81 antigen [ Mus musculus ] |
| Official Symbol | CD81 |
| Synonyms | CD81; CD81 antigen; Tapa1; Tapa-1; Tspan28; |
| Gene ID | 12520 |
| mRNA Refseq | NM_133655 |
| Protein Refseq | NP_598416 |
| UniProt ID | P35762 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD81 Products
Required fields are marked with *
My Review for All CD81 Products
Required fields are marked with *
0
Inquiry Basket
