Recombinant Mouse CD81 Protein (116-201 aa), GST-tagged

• Cat.No.: CD81-400M
• Product Overview: Recombinant Mouse CD81 Protein (116-201 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Mouse
• Source: E.coli
• Tag: GST
• Protein Length: 116-201 aa
• Description: May play an important role in the regulation of lymphoma cell growth. May be involved in the acrosome reaction.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 36.4 kDa
• AA Sequence: KDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNALTTLTTTILRNSLCPSGGNILTPLLQQDCHQKIDELFSGK
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: Cd81 CD81 antigen [ Mus musculus ]
• Official Symbol: CD81
• Synonyms: CD81; CD81 antigen; Tapa1; Tapa-1; Tspan28
• Gene ID: 12520
• mRNA Refseq: NM_133655
• Protein Refseq: NP_598416
• UniProt ID: P35762