Recombinant Mouse Cd63 protein, His-tagged

• Cat.No.: Cd63-2669M
• Product Overview: Recombinant Mouse Cd63 protein(P41731)(103-203aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• ProteinLength: 103-203aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 15.5
• AA Sequence: AGYVFRDQVKSEFNKSFQQQMQNYLKDNKTATILDKLQKENNCCGASNYTDWENIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGCVETIAIWLRKNI
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Cd63 CD63 antigen [ Mus musculus ]
• Official Symbol: Cd63
• Synonyms: CD63; CD63 antigen; melanoma 1 antigen; ME491; C75951; Tspan30; MGC103180; MGC107286
• Gene ID: 12512
• mRNA Refseq: NM_001042580
• Protein Refseq: NP_001036045