Recombinant Human CD63 Protein

• Cat.No.: CD63-0840H
• Product Overview: Human CD63 full-length ORF (NP_001771.1) recombinant protein without tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Description: The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The encoded protein is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker. Deficiency of this protein is associated with Hermansky-Pudlak syndrome. Also this gene has been associated with tumor progression. Alternative splicing results in multiple transcript variants encoding different protein isoforms. [provided by RefSeq, Apr 2012]
• Form: Liquid
• Molecular Mass: 25.6 kDa
• AA Sequence: MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Usage: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: CD63 CD63 molecule [ Homo sapiens ]
• Official Symbol: CD63
• Synonyms: CD63; CD63 molecule; CD63 antigen (melanoma 1 antigen), MLA1; CD63 antigen; ME491; TSPAN30; tspan-30; granulophysin; tetraspanin-30; melanoma-associated antigen MLA1; CD63 antigen (melanoma 1 antigen); melanoma-associated antigen ME491; ocular melanoma-associated antigen; lysosomal-associated membrane protein 3; lysosome-associated membrane glycoprotein 3; MLA1; LAMP-3; OMA81H
• Gene ID: 967
• mRNA Refseq: NM_001257389
• Protein Refseq: NP_001244318
• MIM: 155740
• UniProt ID: P08962