Recombinant Mouse Cd47 protein, His-tagged

• Cat.No.: CD47-3094M
• Product Overview: Recombinant Mouse Cd47(Gln19-Pro158) fused with His tag at C-terminal was expressed in HEK293.

Specification

• Species: Mouse
• Source: HEK293
• Tag: His
• Protein Length: Gln19-Pro158
• Description: CD47 is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The protein is also a receptor for the C-terminal cell-binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This protein has broad tissue distribution, and is reduced in expression on Rh erythrocytes.
• Form: Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
• AA Sequence: QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTS AKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTAFNTDQGSACSYEEEKG GCKLVSWFSPVDHHHHHH
• Endotoxin: Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Quality Control Test: 61.3 kDa
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
  Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
  Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
  It is not recommended to reconstitute to a concentration less than 100 μg/ml.
  Dissolve the lyophilized protein in ddH2O.
  Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: Cd47 CD47 antigen (Rh-related antigen, integrin-associated signal transducer) [ Mus musculus ]
• Official Symbol: Cd47
• Synonyms: CD47; CD47 antigen (Rh-related antigen, integrin-associated signal transducer); leukocyte surface antigen CD47; Rh-related antigen; integrin-associated protein; IAP; Itgp; AA407862; AI848868; AW108519; 9130415E20Rik; B430305P08Rik
• Gene ID: 16423
• mRNA Refseq: NM_010581
• Protein Refseq: NP_034711
• UniProt ID: Q61735
• Chromosome Location: 16; 16 B5
• Pathway: Cell surface interactions at the vascular wall, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; Hemostasis, organism-specific biosystem; Signal regulatory protein (SIRP) family interactions, organism-specific biosystem
• Function: protein binding; thrombospondin receptor activity