Recombinant Mouse CD163 Protein (86-365 aa), His-tagged

• Cat.No.: CD163-1022M
• Product Overview: Recombinant Mouse CD163 Protein (86-365 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 86-365 aa
• Description: Involved in clearance and endocytosis of hoglobin/haptoglobin complexes by macrophages and may thereby protect tissues from free hoglobin-mediated oxidative damage. May play a role in the uptake and recycling of iron, via endocytosis of hoglobin/haptoglobin and subsequent breakdown of he. Binds hoglobin/haptoglobin complexes in a calcium-dependent and pH-dependent manner. Induces a cascade of intracellular signals that involves tyrosine kinase-dependent calcium mobilization, inositol triphosphate production and secretion of IL6 and CSF1 .After shedding, the soluble form (sCD163) may play an anti-inflammatory role.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 34.2 kDa
• AA Sequence: VVCQQLGCPTSIKALGWANSSAGSGYIWMDKVSCTGNESALWDCKHDGWGKHNCTHEKDAGVTCSDGSNLEMRLVNSAGHRCLGRVEIKFQGKWGTVCDDNFSKDHASVICKQLGCGSAISFSGSAKLGAGSGPIWLDDLACNGNESALWDCKHRGWGKHNCDHAEDVGVICLEGADLSLRLVDGVSRCSGRLEVRFQGEWGTVCDDNWDLRDASVVCKQLGCPTAISAIGRVNASEGSGQIWLDNISCEGHEATLWECKHQEWGKHYCHHREDAGVTCS
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: Cd163 CD163 antigen [ Mus musculus ]
• Official Symbol: CD163
• Synonyms: CD163; CD163 antigen; CD163v2; CD163v3
• Gene ID: 93671
• mRNA Refseq: NM_001170395
• Protein Refseq: NP_001163866
• UniProt ID: Q2VLH6