Recombinant Mouse CD163 Protein (86-365 aa), His-tagged
Cat.No. : | CD163-1667M |
Product Overview : | Recombinant Mouse CD163 Protein (86-365 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 86-365 aa |
Description : | Involved in clearance and endocytosis of hoglobin/haptoglobin complexes by macrophages and may thereby protect tissues from free hoglobin-mediated oxidative damage. May play a role in the uptake and recycling of iron, via endocytosis of hoglobin/haptoglobin and subsequent breakdown of he. Binds hoglobin/haptoglobin complexes in a calcium-dependent and pH-dependent manner. Induces a cascade of intracellular signals that involves tyrosine kinase-dependent calcium mobilization, inositol triphosphate production and secretion of IL6 and CSF1 .After shedding, the soluble form (sCD163) may play an anti-inflammatory role. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 32.2 kDa |
AA Sequence : | VVCQQLGCPTSIKALGWANSSAGSGYIWMDKVSCTGNESALWDCKHDGWGKHNCTHEKDAGVTCSDGSNLEMRLVNSAGHRCLGRVEIKFQGKWGTVCDDNFSKDHASVICKQLGCGSAISFSGSAKLGAGSGPIWLDDLACNGNESALWDCKHRGWGKHNCDHAEDVGVICLEGADLSLRLVDGVSRCSGRLEVRFQGEWGTVCDDNWDLRDASVVCKQLGCPTAISAIGRVNASEGSGQIWLDNISCEGHEATLWECKHQEWGKHYCHHREDAGVTCS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Cd163 CD163 antigen [ Mus musculus ] |
Official Symbol | CD163 |
Synonyms | CD163; CD163 antigen; CD163v2; CD163v3; |
Gene ID | 93671 |
mRNA Refseq | NM_001170395 |
Protein Refseq | NP_001163866 |
UniProt ID | Q2VLH6 |
◆ Recombinant Proteins | ||
CD163-6755H | Recombinant Human CD163 protein, His-Avi-tagged | +Inquiry |
CD163-94P | Recombinant Porcine CD163 | +Inquiry |
CD163-151H | Recombinant Human CD163 Protein, DYKDDDDK-tagged | +Inquiry |
CD163-1687M | Recombinant Mouse CD163 protein, His-tagged | +Inquiry |
CD163-182H | Recombinant Human CD163 Protein, C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD163-7683HCL | Recombinant Human CD163 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD163 Products
Required fields are marked with *
My Review for All CD163 Products
Required fields are marked with *
0
Inquiry Basket