Recombinant Mouse Ccl25 protein, His-tagged

• Cat.No.: Ccl25-2655M
• Product Overview: Recombinant Mouse Ccl25 protein(O35903)(25-144aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 25-144aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 18 kDa
• AA Sequence: GAFEDCCLGYQHRIKWNVLRHARNYHQQEVSGSCNLRAVRFYFRQKVVCGNPEDMNVKRAMRILTARKRLVHWKSASDSQTERKKSNHMKSKVENPNSTSVRSATLGHPRMVMMPRKTNN
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Ccl25 chemokine (C-C motif) ligand 25 [ Mus musculus ]
• Official Symbol: Ccl25
• Synonyms: CCL25; chemokine (C-C motif) ligand 25; C-C motif chemokine 25; thymus-expressed chemokine; small inducible chemokine 25; small inducible cytokine A25; TECK; CKb15; Scya25; AI852536; A130072A22Rik
• Gene ID: 20300
• mRNA Refseq: NM_009138
• Protein Refseq: NP_033164