Recombinant Mouse Ccl21c protein(24-133aa)

• Cat.No.: Ccl21c-532M
• Product Overview: Recombinant Mouse Ccl21c protein(P86793)(24-133aa) was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• Protein Length: 24-133aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 12.8 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFLPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG

Gene Information

• Gene Name: Ccl21c chemokine (C-C motif) ligand 21C (leucine) [ Mus musculus ]
• Official Symbol: Ccl21c
• Synonyms: CCL21C; chemokine (C-C motif) ligand 21C (leucine); C-C motif chemokine 21c; 6Ckine; Ccl21-leu; C-C motif chemokine 21b; beta chemokine exodus-2; beta-chemokine exodus-2; Small-inducible cytokine A21b; small inducible cytokine A21c; small-inducible cytokine A21c; thymus-derived chemotactic agent 4; SLC; CKb9; TCA4; Ccl21b; Scya21; Scya21b; Scya21c; exodus-2
• Gene ID: 65956
• mRNA Refseq: NM_023052
• Protein Refseq: NP_075539